CNOT4 Antibody - middle region : Biotin

CNOT4 Antibody - middle region : Biotin
Artikelnummer
AVIARP57877_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: CNOT4 has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT4

Key Reference: Winkler,G.S., (2004) J. Mol. Biol. 337 (1), 157-165

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: AGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CCR4-NOT transcription complex subunit 4

Protein Size: 639

Purification: Affinity Purified

Subunit: 4
Mehr Informationen
Artikelnummer AVIARP57877_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57877_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4850
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×