COPG2 Antibody - N-terminal region : HRP

COPG2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54845_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coa

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPG2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coatomer subunit gamma-2

Protein Size: 871

Purification: Affinity Purified

Subunit: gamma-2
Mehr Informationen
Artikelnummer AVIARP54845_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54845_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26958
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×