Cpne2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cpne2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: QCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRTETAVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Copine-2

Protein Size: 548

Purification: Affinity Purified

• Artikelnummer: AVIARP55509_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55509_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 234577
• Wirt: Rabbit