CRTAC1 Antibody - N-terminal region : HRP

CRTAC1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57101_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRTAC1

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cartilage acidic protein 1

Protein Size: 661

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57101_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57101_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55118
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×