English
CST9 Antibody - middle region : HRP
CST9 Antibody - middle region : HRP
Artikelnummer
AVIARP59193_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: CST9 is part of the cystatin superfamily which encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CST9
Molecular Weight: 18kDa
Peptide Sequence: Synthetic peptide located within the following region: LRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLE
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Cystatin-9
Protein Size: 159
Purification: Affinity Purified
Description of Target: CST9 is part of the cystatin superfamily which encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CST9
Molecular Weight: 18kDa
Peptide Sequence: Synthetic peptide located within the following region: LRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLE
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Cystatin-9
Protein Size: 159
Purification: Affinity Purified
| Artikelnummer | AVIARP59193_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP59193_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 128822 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
