CSTB Antibody - N-terminal region : Biotin

CSTB Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP59177_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CSTB

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: ADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cystatin-B

Protein Size: 98

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59177_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59177_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Sheep (Ovine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 1476
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×