CXorf26 Antibody - middle region : FITC

CXorf26 Antibody - middle region : FITC
Artikelnummer
AVIARP56931_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CXorf26

Key Reference: Cheng,J., (2005) Science 308 (5725), 1149-1154

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: KFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0368 protein Cxorf26

Protein Size: 233

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56931_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56931_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51260
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×