Cyb5r4 Antibody - N-terminal region : Biotin

Cyb5r4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56860_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome b5 reductase 4

Protein Size: 494

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56860_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56860_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 266690
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×