Cyp4x1 Antibody - C-terminal region : Biotin

Cyp4x1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55764_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Cyp4x1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: GMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPFSSGPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 4X1

Protein Size: 507

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55764_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55764_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81906
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×