DBNDD2 Antibody - middle region : Biotin

DBNDD2 Antibody - middle region : Biotin
Artikelnummer
AVIARP56283_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: DBNDD2 may modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro). .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DBNDD2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: DPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dysbindin domain-containing protein 2

Protein Size: 161

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56283_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56283_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55861
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×