DBP Antibody - C-terminal region : HRP

DBP Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57959_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: DBP is a member of the PAR bZIP (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It is transcriptional activator that recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. The protein is not essential for circadian rhythm generation, but modulates important clock output genes.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DBP

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: D site-binding protein

Protein Size: 325

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57959_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57959_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1628
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×