DCUN1D4 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCUN1D4

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: TLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPASGDDLSA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DCN1-like protein 4

Protein Size: 257

Purification: Affinity Purified

• Artikelnummer: AVIARP54512_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54512_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23142
• Wirt: Rabbit