Dennd1a Antibody - C-terminal region : FITC

Dennd1a Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57502_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Dennd1a is a guanine nucleotide exchange factor (GEF) for RAB35. It may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Molecular Weight: 111kDa

Peptide Sequence: Synthetic peptide located within the following region: QPLGQAKSLEDLRAPKDLREQPGSFDYQRLDLCRSERGLSMAAALKLAHP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DENN domain-containing protein 1A

Protein Size: 1016

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57502_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57502_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 227801
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×