DEPDC1 Antibody - middle region : HRP

DEPDC1 Antibody - middle region : HRP
Artikelnummer
AVIARP56317_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of DEPDC1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DEPDC1

Molecular Weight: 89kDa

Peptide Sequence: Synthetic peptide located within the following region: PEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DEP domain-containing protein 1A

Protein Size: 811

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56317_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56317_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55635
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×