DKK1 Antibody - C-terminal region : Biotin

DKK1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55048_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DKK1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dickkopf-related protein 1

Protein Size: 266

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55048_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55048_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22943
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×