DKK1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DKK1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dickkopf-related protein 1

Protein Size: 266

Purification: Affinity Purified

• Artikelnummer: AVIARP55048_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55048_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22943
• Wirt: Rabbit