Dkk2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Dkk2 antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer's disease.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: NGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dickkopf-related protein 2

Protein Size: 259

Purification: Affinity Purified

• Artikelnummer: AVIARP55047_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55047_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56811
• Wirt: Rabbit