DNAH6 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene belongs to the dynein family, whose members encode large proteins that are constituents of the microtubule-associated motor protein complex. This complex is composed of dynein heavy, intermediate and light chains, which can be axonemal or cytoplasmic. This protein is an axonemal dynein heavy chain. It is involved in producing force for ciliary beating by using energy from ATP hydrolysis. Mutations in this gene may cause primary ciliary dyskinesia (PCD) as well as heterotaxy.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DYH6

Key Reference: N/A

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: dynein heavy chain 6, axonemal

Protein Size: 408

Purification: Affinity purified

• Artikelnummer: AVIARP55679_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55679_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 1768
• Wirt: Rabbit