Dnaja1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Dnaja1 is a co-chaperone of Hsc70. Dnaja1 seems to play a role in protein import into mitochondria.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DnaJ homolog subfamily A member 1

Protein Size: 397

Purification: Affinity Purified

• Artikelnummer: AVIARP54580_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54580_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 15502
• Wirt: Rabbit