Dnajb1 Antibody - C-terminal region : HRP

Dnajb1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54796_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Dnajb1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: VFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DnaJ homolog subfamily B member 1

Protein Size: 340

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54796_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54796_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81489
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×