DPPA4 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: DPPA4 may play a role in maintaining cell pluripotentiality.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA4

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Developmental pluripotency-associated protein 4

Protein Size: 304

Purification: Affinity Purified

• Artikelnummer: AVIARP57139_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57139_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55211
• Wirt: Rabbit