DPY19L4 Antibody - middle region : HRP

DPY19L4 Antibody - middle region : HRP
Artikelnummer
AVIARP55806_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPY19L4

Key Reference: Tsuritani,K., (2007) Genome Res. 17 (7), 1005-1014

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein dpy-19 homolog 4

Protein Size: 723

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55806_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55806_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 286148
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×