DUS1L Antibody - middle region : FITC

DUS1L Antibody - middle region : FITC
Artikelnummer
AVIARP57616_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DUS1L

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like

Protein Size: 473

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57616_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57616_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64118
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×