EFEMP2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fat

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EFEMP2

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EGF-containing fibulin-like extracellular matrix protein 2

Protein Size: 443

Purification: Affinity Purified

• Artikelnummer: AVIARP55351_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55351_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 30008
• Wirt: Rabbit