EFEMP2 Antibody - middle region : HRP

EFEMP2 Antibody - middle region : HRP
Artikelnummer
AVIARP55351_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fat

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EFEMP2

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: EGF-containing fibulin-like extracellular matrix protein 2

Protein Size: 443

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55351_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55351_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 30008
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×