EHD4 Antibody - middle region : HRP

EHD4 Antibody - middle region : HRP
Artikelnummer
AVIARP55432_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EHD4

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: EH domain-containing protein 4

Protein Size: 541

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55432_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55432_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 30844
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×