Eif2c3 Antibody - N-terminal region : Biotin

Eif2c3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58812_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Eif2c3 is required for RNA-mediated gene silencing (RNAi). It binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. It lacks endonuclease activity and does not appear to cleave target mRNAs.

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein argonaute-3

Protein Size: 860

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58812_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58812_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 214150
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×