EIF5A2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.EIF5A2 is involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. EIF5A2 functions as a regulator of apoptosis.EIF5A2 mediates effects of polyamines on neuronal process extension and survival.EIF5A2 may play an important role in brain development and function, and in skeletal muscle stem cell differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF5A2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Eukaryotic translation initiation factor 5A-2

Protein Size: 153

Purification: Affinity Purified

• Artikelnummer: AVIARP57402_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57402_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56648
• Wirt: Rabbit