ELMOD2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ELMOD2

Key Reference: Bowzard,J.B., (2007) J. Biol. Chem. 282 (24), 17568-17580

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ELMO domain-containing protein 2

Protein Size: 293

Purification: Affinity Purified

• Artikelnummer: AVIARP55604_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55604_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 255520
• Wirt: Rabbit