ELP2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ELP2

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Elongator complex protein 2

Protein Size: 826

Purification: Affinity Purified

• Artikelnummer: AVIARP57179_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57179_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55250
• Wirt: Rabbit