Endov Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: ENDOV selectively cleaves DNA at the second phosphodiester bond 3' to hypoxanthine- and uracil-containing nucleotides. It shows higher activity towards single-stranded than double-stranded DNA and towards hypoxanthine than uracil..

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: VACHLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endonuclease V

Protein Size: 338

Purification: Affinity Purified

• Artikelnummer: AVIARP55675_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55675_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 338371
• Wirt: Rabbit