ENDOV Antibody - middle region : FITC

ENDOV Antibody - middle region : FITC
Artikelnummer
AVIARP55675_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: A730011L01Rik selectively cleaves DNA at the second phosphodiester bond 3' to hypoxanthine- and uracil-containing nucleotides. It shows higher activity towards single-stranded than double-stranded DNA and towards hypoxanthine than uracil..

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: VACHLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endonuclease V

Protein Size: 338

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55675_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55675_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 338371
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×