ENOPH1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENOPH1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Enolase-phosphatase E1

Protein Size: 261

Purification: Affinity Purified

• Artikelnummer: AVIARP57529_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57529_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 58478
• Wirt: Rabbit