EPB41L2 Antibody - middle region : Biotin

EPB41L2 Antibody - middle region : Biotin
Artikelnummer
AVIARP54569_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: EPB41L2 contains 1 FERM domain. The exact function of EPB41L2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPB41L2

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Band 4.1-like protein 2

Protein Size: 603

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54569_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54569_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 2037
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×