EPB41L2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EPB41L2 contains 1 FERM domain. The exact function of EPB41L2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPB41L2

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Band 4.1-like protein 2

Protein Size: 603

Purification: Affinity Purified

• Artikelnummer: AVIARP54569_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54569_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 2037
• Wirt: Rabbit