EPN1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPN1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epsin-1

Protein Size: 662

Purification: Affinity Purified

• Artikelnummer: AVIARP54940_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54940_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 29924
• Wirt: Rabbit