EPN2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: EPN2 is a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPN2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epsin 2 EMBL AAH93974.1

Protein Size: 584

Purification: Affinity Purified

• Artikelnummer: AVIARP55480_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55480_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22905
• Wirt: Rabbit