EPS8 Antibody - C-terminal region : Biotin

EPS8 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54727_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the transduction of signals from Ras to Rac and growth factor-mediated actin remodeling. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse EPS8

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: VFNQITVQKAALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: epidermal growth factor receptor kinase substrate 8

Protein Size: 561

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54727_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54727_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2059
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×