ERCC4 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERCC4

Molecular Weight: 101kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA repair endonuclease XPF

Protein Size: 916

Purification: Affinity Purified

• Artikelnummer: AVIARP58272_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58272_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2072
• Wirt: Rabbit