EYA3 Antibody - middle region : HRP

EYA3 Antibody - middle region : HRP
Artikelnummer
AVIARP57974_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EYA3

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Eyes absent homolog 3

Protein Size: 447

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57974_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57974_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2140
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×