FAIM Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAIM

Key Reference: Segura,M.F., (2007) J. Neurosci. 27 (42), 11228-11241

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fas apoptotic inhibitory molecule 1

Protein Size: 213

Purification: Affinity Purified

• Artikelnummer: AVIARP56237_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56237_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 55179
• Wirt: Rabbit