FAM124A Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM124A

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM124A

Protein Size: 582

Purification: Affinity Purified

• Artikelnummer: AVIARP55453_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55453_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 220108
• Wirt: Rabbit