English
FAM135B Antibody - middle region : HRP
FAM135B Antibody - middle region : HRP
Artikelnummer
AVIARP56771_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM135B
Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968
Molecular Weight: 156kDa
Peptide Sequence: Synthetic peptide located within the following region: TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Protein FAM135B
Protein Size: 1406
Purification: Affinity Purified
Description of Target: The function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM135B
Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968
Molecular Weight: 156kDa
Peptide Sequence: Synthetic peptide located within the following region: TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Protein FAM135B
Protein Size: 1406
Purification: Affinity Purified
| Artikelnummer | AVIARP56771_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56771_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 51059 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
