FAM78A Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact functions of FAM78A remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM78A

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: WRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNAN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM78A

Protein Size: 283

Purification: Affinity Purified

• Artikelnummer: AVIARP55411_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55411_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 286336
• Wirt: Rabbit