FAM80A Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of FAM80A is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM80A

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-acetylaspartyl-glutamate synthetase A

Protein Size: 350

Purification: Affinity Purified

• Artikelnummer: AVIARP55677_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55677_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 284716
• Wirt: Rabbit