FANCL Antibody - middle region : Biotin

FANCL Antibody - middle region : Biotin
Artikelnummer
AVIARP56321_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FANCL

Key Reference: Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase FANCL

Protein Size: 380

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56321_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56321_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 55120
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×