FANCL Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FANCL

Key Reference: Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: E3 ubiquitin-protein ligase FANCL

Protein Size: 380

Purification: Affinity Purified

• Artikelnummer: AVIARP56321_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56321_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit, Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 55120
• Wirt: Rabbit