Fbxo22 Antibody - middle region : HRP

Fbxo22 Antibody - middle region : HRP
Artikelnummer
AVIARP54859_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: HFIKDSKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLHRVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: F-box only protein 22 Ensembl ENSMUSP00000117106

Protein Size: 299

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54859_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54859_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 71999
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×