FCN1 Antibody - middle region : FITC

FCN1 Antibody - middle region : FITC
Artikelnummer
AVIARP54606_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1(FCN1) is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FCN1

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: HQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDND

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ficolin-1

Protein Size: 326

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54606_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54606_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2219
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×