FDXR Antibody - middle region : Biotin

FDXR Antibody - middle region : Biotin
Artikelnummer
AVIARP54707_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FDXR

Key Reference: Trapasso,F., (2008) J. Biol. Chem. 283 (20), 13736-13744

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADPH:adrenodoxin oxidoreductase, mitochondrial

Protein Size: 491

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54707_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54707_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2232
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×